Recombinant Human CXCL11 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O14625

Gene Name: CXCL11

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Phe22

End Site: Phe94

Coverage: 1.00

Isoelectric Point: 9

Core Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 32%, Pig - 82%, Cynomolgus monkey - 99%

Alternative gene names: ITAC; SCYB11; SCYB9B

Alternative protein names: C-X-C motif chemokine 11; Beta-R1; H174; Interferon gamma-inducible protein 9; IP-9; Interferon-inducible T-cell alpha chemoattractant; I-TAC; Small-inducible cytokine B11

Protein name: C-X-C motif chemokine ligand 11

Full length: 94 amino acids

Entry name: CXL11_HUMAN

Product panel: Cytokines

• SKU: ASBPP-3210-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3210-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6373