Recombinant Human CXCL11 Protein

Recombinant Human CXCL11 Protein
SKU
ASBPP-3209-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O14625

Gene Name: CXCL11

Expression System: Escherichia coli

Molecular Weight: 51 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Phe22

End Site: Phe94

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 32%, Pig - 82%, Cynomolgus monkey - 99%

Alternative gene names: ITAC; SCYB11; SCYB9B

Alternative protein names: C-X-C motif chemokine 11; Beta-R1; H174; Interferon gamma-inducible protein 9; IP-9; Interferon-inducible T-cell alpha chemoattractant; I-TAC; Small-inducible cytokine B11

Protein name: C-X-C motif chemokine ligand 11

Full length: 94 amino acids

Entry name: CXL11_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3209-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3209-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6373
Product information (PDF)
×
MSDS (PDF)
×