Recombinant Human CXCL12 Protein

Recombinant Human CXCL12 Protein
SKU
ASBPP-3056-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P48061

Gene Name: CXCL12

Expression System: Escherichia coli

Molecular Weight: 51 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Lys22

End Site: Met93

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: SDF1; SDF1A; SDF1B

Alternative protein names: Stromal cell-derived factor 1; SDF-1; hSDF-1; C-X-C motif chemokine 12; Intercrine reduced in hepatomas; IRH; hIRH; Pre-B cell growth-stimulating factor; PBSF) [Cleaved into: SDF-1-beta(3-72; SDF-1-alpha(3-67]

Protein name: C-X-C motif chemokine ligand 12

Full length: 93 amino acids

Entry name: SDF1_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3056-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3056-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6387
Product information (PDF)
×
MSDS (PDF)
×