Recombinant Human CXCL14 Protein

Recombinant Human CXCL14 Protein
SKU
ASBPP-3194-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O95715

Gene Name: CXCL14

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Ser35

End Site: Glu111

Coverage: 1.00

Isoelectric Point: 9.5

Core Sequence: SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 31%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: MIP2G; NJAC; SCYB14

Alternative protein names: C-X-C motif chemokine 14; Chemokine BRAK; MIP-2G; Small-inducible cytokine B14

Protein name: C-X-C motif chemokine ligand 14

Full length: 111 amino acids

Entry name: CXL14_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3194-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3194-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9547
Product information (PDF)
×
MSDS (PDF)
×