Recombinant Human CYB5B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43169

Gene Name: CYB5B

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Glu21

End Site: Lys120

Coverage: 0.78

Isoelectric Point: 4.5

Core Sequence: ETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 77%, Pig - 85%

Alternative gene names: CYB5M; OMB5

Alternative protein names: Cytochrome b5 type B; Cytochrome b5 outer mitochondrial membrane isoform

Protein name: cytochrome b5 type B

Full length: 150 amino acids

Entry name: CYB5B_HUMAN

• SKU: ASBPP-3752-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3752-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 80777