Recombinant Human Cytochrome P450 24A1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q07973

Gene Name: CYP24A1

Expression System: Escherichia coli

Molecular Weight: 56 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Pro36

End Site: Arg514

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: PQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 85%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: CYP24

Alternative protein names: 1; 25-dihydroxyvitamin D(3) 24-hydroxylase; mitochondrial; 24-OHase; Vitamin D(3) 24-hydroxylase; Cytochrome P450 24A1; Cytochrome P450-CC24

Protein name: cytochrome P450 family 24 subfamily A member 1

Full length: 514 amino acids

Entry name: CP24A_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4154-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4154-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1591