Recombinant Human CYP4F3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q08477

Gene Name: CYP4F3

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Ile271

End Site: Glu360

Coverage: 0.19

Isoelectric Point: 4.5

Core Sequence: IQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 90%, Cynomolgus monkey - 99%

Alternative gene names: LTB4H

Alternative protein names: Cytochrome P450 4F3; 20-hydroxyeicosatetraenoic acid synthase; 20-HETE synthase; CYPIVF3; Cytochrome P450-LTB-omega; Docosahexaenoic acid omega-hydroxylase CYP4F3; Leukotriene-B(4) 20-monooxygenase 2; Leukotriene-B(4) omega-hydroxylase 2

Protein name: cytochrome P450 family 4 subfamily F member 3

Full length: 520 amino acids

Entry name: CP4F3_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3200-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3200-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 4051