Recombinant Human DDX54 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TDD1

Gene Name: DDX54

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Ser41

End Site: Thr120

Coverage: 0.10

Isoelectric Point: 9

Core Sequence: SEDGEFEIQAEDDARARKLGPGRPLPTFPTSECTSDVEPDTREMVRAQNKKKKKSGGFQSMGLSYPVFKGIMKKGYKVPT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: ATP-dependent RNA helicase DDX54; ATP-dependent RNA helicase DP97; DEAD box RNA helicase 97 kDa; DEAD box protein 54

Protein name: DEAD-box helicase 54

Full length: 881 amino acids

Entry name: DDX54_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3796-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3796-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 79039