Recombinant Human DIP2A Protein

Recombinant Human DIP2A Protein
SKU
ASBPP-10378-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q14689

Gene Name: DIP2A

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Ala11

End Site: Arg190

Coverage: 0.12

Isoelectric Point: 9

Core Sequence: APLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSHPGGR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Pig - 84%, Cynomolgus monkey - 99%

Alternative gene names: C21orf106; DIP2; KIAA0184

Alternative protein names: Disco-interacting protein 2 homolog A; DIP2 homolog A

Protein name: disco interacting protein 2 homolog A

Full length: 1571 amino acids

Entry name: DIP2A_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-10378-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10378-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 23181
Product information (PDF)
×
MSDS (PDF)
×