Recombinant Human DIP2A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q14689

Gene Name: DIP2A

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Ala11

End Site: Arg190

Coverage: 0.12

Isoelectric Point: 9

Core Sequence: APLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSHPGGR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Pig - 84%, Cynomolgus monkey - 99%

Alternative gene names: C21orf106; DIP2; KIAA0184

Alternative protein names: Disco-interacting protein 2 homolog A; DIP2 homolog A

Protein name: disco interacting protein 2 homolog A

Full length: 1571 amino acids

Entry name: DIP2A_HUMAN

Product panel: Enzyme

• SKU: ASBPP-10378-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10378-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23181