Recombinant Human DKK2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UBU2

Gene Name: DKK2

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Ala51

End Site: Arg150

Coverage: 0.48

Isoelectric Point: 9.5

Core Sequence: ANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%

Alternative gene names: /

Alternative protein names: Dickkopf-related protein 2; Dickkopf-2; Dkk-2; hDkk-2

Protein name: dickkopf WNT signaling pathway inhibitor 2

Full length: 259 amino acids

Entry name: DKK2_HUMAN

• SKU: ASBPP-3788-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3788-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 27123