Recombinant Human DLGAP3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95886

Gene Name: DLGAP3

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ala571

End Site: Arg670

Coverage: 0.11

Isoelectric Point: 10.5

Core Sequence: AAEGPARRCSSADGLDGPAMGARTLELAPVPPRASPKPPTLIIKTIPGREELRSLARQRKWRPSIGVQVETISDSDTENRSRREFHSIGVQVEEDKRRAR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%

Alternative gene names: DAP3

Alternative protein names: Disks large-associated protein 3; DAP-3; PSD-95/SAP90-binding protein 3; SAP90/PSD-95-associated protein 3; SAPAP3

Protein name: DLG associated protein 3

Full length: 979 amino acids

Entry name: DLGP3_HUMAN

• SKU: ASBPP-3748-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3748-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 58512