Recombinant Human DLX1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P56177

Gene Name: DLX1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ser81

End Site: Glu160

Coverage: 0.34

Isoelectric Point: 10

Core Sequence: SPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 69%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Homeobox protein DLX-1

Protein name: distal-less homeobox 1

Full length: 255 amino acids

Entry name: DLX1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3195-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3195-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1745