Recombinant Human DMRT1 Protein

Recombinant Human DMRT1 Protein
SKU
ASBPP-3230-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5R6

Gene Name: DMRT1

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Pro71

End Site: Glu150

Coverage: 0.25

Isoelectric Point: 10

Core Sequence: PRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLPSAAELLVKRE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 77%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: DMT1

Alternative protein names: Doublesex- and mab-3-related transcription factor 1; DM domain expressed in testis protein 1

Protein name: doublesex and mab-3 related transcription factor 1

Full length: 373 amino acids

Entry name: DMRT1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3230-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3230-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 1761
Product information (PDF)
×
MSDS (PDF)
×