Recombinant Human DMRTC2 Protein

Recombinant Human DMRTC2 Protein
SKU
ASBPP-3221-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8IXT2

Gene Name: DMRTC2

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Gln91

End Site: Pro170

Coverage: 0.23

Isoelectric Point: 11

Core Sequence: QEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENIAPQPQTPHGAVLLAPTPPGKNSCGPLLLSHPPEASPLSWTP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Pig - 70%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Doublesex- and mab-3-related transcription factor C2

Protein name: DMRT like family C2

Full length: 367 amino acids

Entry name: DMRTD_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3221-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3221-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 63946
Product information (PDF)
×
MSDS (PDF)
×