Recombinant Human DNER Protein

Recombinant Human DNER Protein
SKU
ASBPP-332-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NFT8

Gene Name: DNER

Expression System: Escherichia coli

Molecular Weight: 38.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Arg151

End Site: Gln390

Coverage: 0.34

Isoelectric Point: 5.5

Core Sequence: RQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 33%, Pig - 92%, Cynomolgus monkey - 98%

Alternative gene names: BET

Alternative protein names: Delta and Notch-like epidermal growth factor-related receptor

Protein name: delta/notch like EGF repeat containing

Full length: 737 amino acids

Entry name: DNER_HUMAN
More Information
SKU ASBPP-332-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-332-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 92737
Product information (PDF)
×
MSDS (PDF)
×