Recombinant Human DPF1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92782

Gene Name: DPF1

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Glu131

End Site: Ala260

Coverage: 0.36

Isoelectric Point: 6.5

Core Sequence: ELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQFYKELAWVPEAQRKHTA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Rat - 74%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: BAF45B; NEUD4

Alternative protein names: Zinc finger protein neuro-d4; BRG1-associated factor 45B; BAF45B; D4; zinc and double PHD fingers family 1

Protein name: double PHD fingers 1

Full length: 387 amino acids

Entry name: DPF1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-4142-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4142-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8193