Recombinant Human DPP9 Protein

Recombinant Human DPP9 Protein
SKU
ASBPP-5710-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86TI2

Gene Name: DPP9

Expression System: Escherichia coli

Molecular Weight: 35 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Gly671

End Site: His850

Coverage: 0.22

Isoelectric Point: 6.5

Core Sequence: GYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERHSIRCPESGEH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 40%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: DPRP2

Alternative protein names: Dipeptidyl peptidase 9; DP9; Dipeptidyl peptidase IV-related protein 2; DPRP-2; Dipeptidyl peptidase IX; DPP IX; Dipeptidyl peptidase-like protein 9; DPLP9

Protein name: dipeptidyl peptidase 9

Full length: 863 amino acids

Entry name: DPP9_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-5710-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-5710-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 91039
Product information (PDF)
×
MSDS (PDF)
×