Recombinant Human DSG1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q02413

Gene Name: DSG1

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Thr391

End Site: Leu540

Coverage: 0.16

Isoelectric Point: 6.5

Core Sequence: TYVVTGNMGSNDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 43%, Pig - 63%, Cynomolgus monkey - 77%

Alternative gene names: CDHF4

Alternative protein names: Desmoglein-1; Cadherin family member 4; Desmosomal glycoprotein 1; DG1; DGI; Pemphigus foliaceus antigen

Protein name: desmoglein 1

Full length: 1049 amino acids

Entry name: DSG1_HUMAN

Product panel: Autoimmune Disease

• SKU: ASBPP-375-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-375-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 1828