Note: Dry Ice fees will be extra-charged
Uniprot: P60981
Gene Name: DSTN
Expression System: Escherichia coli
Molecular Weight: 19.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 96%
Start Site: Met1
End Site: Val165
Coverage: 1.00
Isoelectric Point: 8
Core Sequence: MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: ACTDP; DSN
Alternative protein names: Destrin; Actin-depolymerizing factor; ADF
Protein name: destrin, actin depolymerizing factor
Full length: 165 amino acids
Entry name: DEST_HUMAN