Recombinant Human EDNRA Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P25101

Gene Name: EDNRA

Expression System: Escherichia coli

Molecular Weight: 8 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Ser31

End Site: Lys80

Coverage: 0.14

Isoelectric Point: 7

Core Sequence: SNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 77%, Pig - 88%, Cynomolgus monkey - 95%

Alternative gene names: ETA; ETRA

Alternative protein names: Endothelin-1 receptor; Endothelin receptor type A; ET-A; ETA-R; hET-AR

Protein name: endothelin receptor type A

Full length: 427 amino acids

Entry name: EDNRA_HUMAN

• SKU: ASBPP-3797-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3797-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1909