Recombinant Human EGFL7 Protein

Recombinant Human EGFL7 Protein
SKU
ASBPP-3097-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHF1

Gene Name: EGFL7

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Cys31

End Site: Arg130

Coverage: 0.44

Isoelectric Point: 8.5

Core Sequence: CAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 79%, Pig - 88%, Cynomolgus monkey - 96%

Alternative gene names: MEGF7

Alternative protein names: Epidermal growth factor-like protein 7; EGF-like protein 7; Multiple epidermal growth factor-like domains protein 7; Multiple EGF-like domains protein 7; NOTCH4-like protein; Vascular endothelial statin; VE-statin; Zneu1

Protein name: EGF like domain multiple 7

Full length: 273 amino acids

Entry name: EGFL7_HUMAN
More Information
SKU ASBPP-3097-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3097-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51162
Product information (PDF)
×
MSDS (PDF)
×