Recombinant Human EIF2B1 Protein

Recombinant Human EIF2B1 Protein
SKU
ASBPP-3965-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q14232

Gene Name: EIF2B1

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Met1

End Site: Leu305

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 93%

Alternative gene names: EIF2BA

Alternative protein names: Translation initiation factor eIF-2B subunit alpha; eIF-2B GDP-GTP exchange factor subunit alpha

Protein name: eukaryotic translation initiation factor 2B subunit alpha

Full length: 305 amino acids

Entry name: EI2BA_HUMAN
More Information
SKU ASBPP-3965-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3965-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1967
Product information (PDF)
×
MSDS (PDF)
×