Recombinant Human ELAC2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BQ52

Gene Name: ELAC2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Thr131

End Site: Gln230

Coverage: 0.13

Isoelectric Point: 7

Core Sequence: TGLPKCVLSGPPQLEKYLEAIKIFSGPLKGIELAVRPHSAPEYEDETMTVYQIPIHSEQRRGKHQPWQSPERPLSRLSPERSSDSESNENEPHLPHGVSQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 75%, Pig - 67%

Alternative gene names: HPC2

Alternative protein names: Zinc phosphodiesterase ELAC protein 2; ElaC homolog protein 2; Heredity prostate cancer protein 2; Ribonuclease Z 2; RNase Z 2; tRNA 3 endonuclease 2; tRNase Z 2

Protein name: elaC ribonuclease Z 2

Full length: 826 amino acids

Entry name: RNZ2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3294-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3294-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 60528