Recombinant Human ELAC2 Protein

Recombinant Human ELAC2 Protein
SKU
ASBPP-3294-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BQ52

Gene Name: ELAC2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Thr131

End Site: Gln230

Coverage: 0.13

Isoelectric Point: 7

Core Sequence: TGLPKCVLSGPPQLEKYLEAIKIFSGPLKGIELAVRPHSAPEYEDETMTVYQIPIHSEQRRGKHQPWQSPERPLSRLSPERSSDSESNENEPHLPHGVSQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 75%, Pig - 67%

Alternative gene names: HPC2

Alternative protein names: Zinc phosphodiesterase ELAC protein 2; ElaC homolog protein 2; Heredity prostate cancer protein 2; Ribonuclease Z 2; RNase Z 2; tRNA 3 endonuclease 2; tRNase Z 2

Protein name: elaC ribonuclease Z 2

Full length: 826 amino acids

Entry name: RNZ2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3294-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3294-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 60528
Product information (PDF)
×
MSDS (PDF)
×