Recombinant Human ERGIC1 Protein

Recombinant Human ERGIC1 Protein
SKU
ASBPP-3798-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q969X5

Gene Name: ERGIC1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Glu51

End Site: Ser220

Coverage: 0.61

Isoelectric Point: 6.5

Core Sequence: EVVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: ERGIC32; KIAA1181

Alternative protein names: Endoplasmic reticulum-Golgi intermediate compartment protein 1; ER-Golgi intermediate compartment 32 kDa protein; ERGIC-32

Protein name: endoplasmic reticulum-golgi intermediate compartment 1

Full length: 290 amino acids

Entry name: ERGI1_HUMAN
More Information
SKU ASBPP-3798-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3798-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57222
Product information (PDF)
×
MSDS (PDF)
×