Recombinant Human ERO1A Protein

Recombinant Human ERO1A Protein
SKU
ASBPP-3232-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96HE7

Gene Name: ERO1A

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Asp111

End Site: Pro220

Coverage: 0.27

Isoelectric Point: 4

Core Sequence: DGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: ERO1L

Alternative protein names: ERO1-like protein alpha; ERO1-L; ERO1-L-alpha; Endoplasmic oxidoreductin-1-like protein; Endoplasmic reticulum oxidoreductase alpha; Oxidoreductin-1-L-alpha

Protein name: endoplasmic reticulum oxidoreductase 1 alpha

Full length: 468 amino acids

Entry name: ERO1A_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3232-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3232-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 30001
Product information (PDF)
×
MSDS (PDF)
×