Recombinant Human EXOC7 Protein

Recombinant Human EXOC7 Protein
SKU
ASBPP-2946-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UPT5

Gene Name: EXOC7

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Glu21

End Site: Ile200

Coverage: 0.25

Isoelectric Point: 5

Core Sequence: EEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENLQRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVKLLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 96%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: EXO70; KIAA1067

Alternative protein names: Exocyst complex component 7; Exocyst complex component Exo70

Protein name: exocyst complex component 7

Full length: 735 amino acids

Entry name: EXOC7_HUMAN
More Information
SKU ASBPP-2946-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2946-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 23265
Product information (PDF)
×
MSDS (PDF)
×