Recombinant Human EXOSC10 Protein

Recombinant Human EXOSC10 Protein
SKU
ASBPP-366-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q01780

Gene Name: EXOSC10

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Pro691

End Site: Lys850

Coverage: 0.18

Isoelectric Point: 10.5

Core Sequence: PFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 77%, Pig - 82%, Cynomolgus monkey - 96%

Alternative gene names: PMSCL; PMSCL2; RRP6

Alternative protein names: Exosome complex component 10; Autoantigen PM/Scl 2; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; Polymyositis/scleroderma autoantigen 100 kDa; PM/Scl-100; Polymyositis/scleroderma autoantigen 2

Protein name: exosome component 10

Full length: 885 amino acids

Entry name: EXOSX_HUMAN

Product panel: Autoimmune Disease,DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-366-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-366-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5394
Product information (PDF)
×
MSDS (PDF)
×