Recombinant Human FAM32A Protein

Recombinant Human FAM32A Protein
SKU
ASBPP-3098-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y421

Gene Name: FAM32A

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met41

End Site: Trp110

Coverage: 0.72

Isoelectric Point: 10.5

Core Sequence: MGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: OTAG12

Alternative protein names: Protein FAM32A; Ovarian tumor-associated gene 12; OTAG-12

Protein name: family with sequence similarity 32 member A

Full length: 112 amino acids

Entry name: FA32A_HUMAN
More Information
SKU ASBPP-3098-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3098-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 26017
Product information (PDF)
×
MSDS (PDF)
×