Note: Dry Ice fees will be extra-charged
Uniprot: Q9Y4F1
Gene Name: FARP1
Expression System: Escherichia coli
Molecular Weight: 23.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 79%
Start Site: Phe331
End Site: Glu530
Coverage: 0.20
Isoelectric Point: 8.5
Core Sequence: FSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAGEPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDE
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 78%, Pig - 74%, Cynomolgus monkey - 95%
Alternative gene names: CDEP; PLEKHC2
Alternative protein names: FERM; ARHGEF and pleckstrin domain-containing protein 1; Chondrocyte-derived ezrin-like protein; FERM; RhoGEF and pleckstrin domain-containing protein 1; Pleckstrin homology domain-containing family C member 2; PH domain-containing family C member 2
Protein name: FERM, ARH/RhoGEF and pleckstrin domain protein 1
Full length: 1045 amino acids
Entry name: FARP1_HUMAN
English
Deutsch
