Recombinant Human FBXL20 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96IG2

Gene Name: FBXL20

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ala151

End Site: Glu360

Coverage: 0.50

Isoelectric Point: 5

Core Sequence: ASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%

Alternative gene names: FBL2

Alternative protein names: F-box/LRR-repeat protein 20; F-box and leucine-rich repeat protein 20; F-box/LRR-repeat protein 2-like

Protein name: F-box and leucine rich repeat protein 20

Full length: 436 amino acids

Entry name: FXL20_HUMAN

• SKU: ASBPP-8145-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-8145-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84961