Recombinant Human FCGR2A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P12318

Gene Name: FCGR2A

Expression System: Escherichia coli

Molecular Weight: 32 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Ala41

End Site: Pro200

Coverage: 0.60

Isoelectric Point: 6.5

Core Sequence: AVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 60%, Pig - 67%, Cynomolgus monkey - 91%

Alternative gene names: CD32; FCG2; FCGR2A1; IGFR2

Alternative protein names: Low affinity immunoglobulin gamma Fc region receptor II-a; IgG Fc receptor II-a; CDw32; Fc-gamma RII-a; Fc-gamma-RIIa; FcRII-a; CD antigen CD32

Protein name: Fc gamma receptor IIa

Full length: 317 amino acids

Entry name: FCG2A_HUMAN

CD Antigen: CD32

Product panel: CD Antigen

• SKU: ASBPP-3102-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3102-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 2212