Recombinant Human FGF3 Protein

Recombinant Human FGF3 Protein
SKU
ASBPP-3347-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P11487

Gene Name: FGF3

Expression System: Escherichia coli

Molecular Weight: 63.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Gly31

End Site: Arg210

Coverage: 0.83

Isoelectric Point: 9.5

Core Sequence: GRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 48%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: INT2

Alternative protein names: Fibroblast growth factor 3; FGF-3; Heparin-binding growth factor 3; HBGF-3; Proto-oncogene Int-2

Protein name: fibroblast growth factor 3

Full length: 239 amino acids

Entry name: FGF3_HUMAN
More Information
SKU ASBPP-3347-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3347-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2248
Product information (PDF)
×
MSDS (PDF)
×