Recombinant Human FLYWCH1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q4VC44

Gene Name: FLYWCH1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 55%

Start Site: Arg341

End Site: Gln410

Coverage: 0.11

Isoelectric Point: 6

Core Sequence: RRQQEKAVETLQAGQDGPGSQVDTLLRGVDSLLYRRGPGPLTLTRPRPRKRAKVEDQELPTQPEAPDEHQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 55%, Pig - 68%, Cynomolgus monkey - 88%

Alternative gene names: KIAA1552

Alternative protein names: FLYWCH-type zinc finger-containing protein 1

Protein name: FLYWCH-type zinc finger 1

Full length: 716 amino acids

Entry name: FWCH1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3203-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3203-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84256