Recombinant Human FOXQ1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9C009

Gene Name: FOXQ1

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Ala11

End Site: Lys190

Coverage: 0.47

Isoelectric Point: 6.5

Core Sequence: AHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDTQGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 78%, Pig - 82%, Cynomolgus monkey - 97%

Alternative gene names: HFH1

Alternative protein names: Forkhead box protein Q1; HNF-3/forkhead-like protein 1; HFH-1; Hepatocyte nuclear factor 3 forkhead homolog 1

Protein name: forkhead box Q1

Full length: 403 amino acids

Entry name: FOXQ1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3121-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3121-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 94234