Recombinant Human FOXR1 Protein

Recombinant Human FOXR1 Protein
SKU
ASBPP-3122-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6PIV2

Gene Name: FOXR1

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Thr11

End Site: Phe120

Coverage: 0.40

Isoelectric Point: 10

Core Sequence: TSHLPLAEQKLARYKLRIVKPPKLPLEKKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEVSGRRKREDLTSTLPSSQPPQKEEDASCSEAAGVESLSQSSSKRSPPRKRF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Pig - 73%, Cynomolgus monkey - 94%

Alternative gene names: FOXN5

Alternative protein names: Forkhead box protein R1; Forkhead box protein N5

Protein name: forkhead box R1

Full length: 292 amino acids

Entry name: FOXR1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3122-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3122-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 283150
Product information (PDF)
×
MSDS (PDF)
×