Recombinant Human GABARAP Protein

Recombinant Human GABARAP Protein
SKU
ASBPP-4010-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O95166

Gene Name: GABARAP

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Gly116

Coverage: 1.00

Isoelectric Point: 9

Core Sequence: MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: FLC3B

Alternative protein names: Gamma-aminobutyric acid receptor-associated protein; GABA(A) receptor-associated protein; MM46

Protein name: GABA type A receptor-associated protein

Full length: 117 amino acids

Entry name: GBRAP_HUMAN
More Information
SKU ASBPP-4010-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4010-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 11337
Product information (PDF)
×
MSDS (PDF)
×