Recombinant Human GADD45B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75293

Gene Name: GADD45B

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Met1

End Site: Arg160

Coverage: 1.00

Isoelectric Point: 4.5

Core Sequence: MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 56%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: MYD118

Alternative protein names: Growth arrest and DNA damage-inducible protein GADD45 beta; Myeloid differentiation primary response protein MyD118; Negative growth regulatory protein MyD118

Protein name: growth arrest and DNA damage inducible beta

Full length: 160 amino acids

Entry name: GA45B_HUMAN

• SKU: ASBPP-4008-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4008-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 4616