Recombinant Human GALM Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96C23

Gene Name: GALM

Expression System: Escherichia coli

Molecular Weight: 39 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Met1

End Site: Ala342

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 89%, Pig - 89%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Galactose mutarotase; Aldose 1-epimerase

Protein name: galactose mutarotase

Full length: 342 amino acids

Entry name: GALM_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3893-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3893-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 130589