Recombinant Human GATAD2B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WXI9

Gene Name: GATAD2B

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Asn101

End Site: Thr200

Coverage: 0.18

Isoelectric Point: 10

Core Sequence: NDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLVLLKKLRQSQLQKENVVQKT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1150

Alternative protein names: Transcriptional repressor p66-beta; GATA zinc finger domain-containing protein 2B; p66/p68

Protein name: GATA zinc finger domain containing 2B

Full length: 593 amino acids

Entry name: P66B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3283-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3283-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 57459