Recombinant Human GATAD2B Protein

Recombinant Human GATAD2B Protein
SKU
ASBPP-3283-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8WXI9

Gene Name: GATAD2B

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Asn101

End Site: Thr200

Coverage: 0.18

Isoelectric Point: 10

Core Sequence: NDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLVLLKKLRQSQLQKENVVQKT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1150

Alternative protein names: Transcriptional repressor p66-beta; GATA zinc finger domain-containing protein 2B; p66/p68

Protein name: GATA zinc finger domain containing 2B

Full length: 593 amino acids

Entry name: P66B_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3283-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3283-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 57459
Product information (PDF)
×
MSDS (PDF)
×