Recombinant Human GCM2 Protein

Recombinant Human GCM2 Protein
SKU
ASBPP-3779-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75603

Gene Name: GCM2

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Arg161

End Site: Asn300

Coverage: 0.29

Isoelectric Point: 6.5

Core Sequence: RPESKSETEARRSAIKRQMASFYQPQKKRIRESEAEENQDSSGHFSNIPPLENPEDFDIVTETSFPIPGQPCPSFPKSDVYKATCDLATFQGDKMPPFQKYSSPRIYLPRPPCSYELANPGYTNSSPYPTLYKDSTSIPN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Pig - 72%

Alternative gene names: GCMB

Alternative protein names: Chorion-specific transcription factor GCMb; hGCMb; GCM motif protein 2; Glial cells missing homolog 2

Protein name: glial cells missing transcription factor 2

Full length: 506 amino acids

Entry name: GCM2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3779-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3779-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9247
Product information (PDF)
×
MSDS (PDF)
×