Recombinant Human GJC1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P36383

Gene Name: GJC1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Trp281

End Site: Lys380

Coverage: 0.28

Isoelectric Point: 9.5

Core Sequence: WNTPSAPPGYNIAVKPDQIQYTELSNAKIAYKQNKANTAQEQQYGSHEENLPADLEALQREIRMAQERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: GJA7

Alternative protein names: Gap junction gamma-1 protein; Connexin-45; Cx45; Gap junction alpha-7 protein

Protein name: gap junction protein gamma 1

Full length: 396 amino acids

Entry name: CXG1_HUMAN

• SKU: ASBPP-3193-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3193-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10052