Recombinant Human GLRX5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86SX6

Gene Name: GLRX5

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Ala32

End Site: Lys157

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: AGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 44%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: C14orf87

Alternative protein names: Glutaredoxin-related protein 5; mitochondrial; Monothiol glutaredoxin-5

Protein name: glutaredoxin 5

Full length: 157 amino acids

Entry name: GLRX5_HUMAN

• SKU: ASBPP-4025-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4025-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 51218