Recombinant Human GMCL1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96IK5

Gene Name: GMCL1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Gln11

End Site: Arg80

Coverage: 0.17

Isoelectric Point: 8

Core Sequence: QPRPALAQQAQGARAGGSARRPDTGDDAAGHGFCYCAGSHKRKRSSGSFCYCHPDSETDEDEEEGDEQQR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Pig - 82%, Cynomolgus monkey - 97%

Alternative gene names: BTBD13; GCL; SPATA29

Alternative protein names: Germ cell-less protein-like 1; Spermatogenesis-associated protein 29

Protein name: germ cell-less 1, spermatogenesis associated

Full length: 515 amino acids

Entry name: GMCL1_HUMAN

• SKU: ASBPP-3227-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3227-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 64395