Recombinant Human GPAM Protein

Recombinant Human GPAM Protein
SKU
ASBPP-3216-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCL2

Gene Name: GPAM

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Thr631

End Site: Glu820

Coverage: 0.23

Isoelectric Point: 5.5

Core Sequence: TISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQRLLGPLLEAYSSAAIFVHNFSGPVPEPEYLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 92%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: GPAT1; KIAA1560

Alternative protein names: Glycerol-3-phosphate acyltransferase 1; mitochondrial; GPAT-1

Protein name: glycerol-3-phosphate acyltransferase, mitochondrial

Full length: 828 amino acids

Entry name: GPAT1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3216-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3216-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57678
Product information (PDF)
×
MSDS (PDF)
×