Note: Dry Ice fees will be extra-charged
Uniprot: Q9HCL2
Gene Name: GPAM
Expression System: Escherichia coli
Molecular Weight: 23.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 96%
Start Site: Thr631
End Site: Glu820
Coverage: 0.23
Isoelectric Point: 5.5
Core Sequence: TISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQRLLGPLLEAYSSAAIFVHNFSGPVPEPEYLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLE
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 92%, Pig - 96%, Cynomolgus monkey - 99%
Alternative gene names: GPAT1; KIAA1560
Alternative protein names: Glycerol-3-phosphate acyltransferase 1; mitochondrial; GPAT-1
Protein name: glycerol-3-phosphate acyltransferase, mitochondrial
Full length: 828 amino acids
Entry name: GPAT1_HUMAN
Product panel: Enzyme