Recombinant Human GPAT2 Protein

Recombinant Human GPAT2 Protein
SKU
ASBPP-3131-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6NUI2

Gene Name: GPAT2

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Leu501

End Site: Cys740

Coverage: 0.32

Isoelectric Point: 6.5

Core Sequence: LRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLAQLSAELLPVFLSEAVGACAVRGLLAGRVPPQGPWELQGILLLSQNELYRQILLLMHLLPQDLLLLKPCQSSYCYCQEVLDRLIQCGLLVAEETPGSRPACDTGRQRLSRKLLWKPSGDFTDSDSDDFGEADGRYFRLSQQSHCPDFFLFLCRLLSPLLKAFAQAAAFLRQGQLPDTELGYTEQLFQFLQATAQEEGIFEC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 86%, Pig - 90%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Glycerol-3-phosphate acyltransferase 2; mitochondrial; GPAT-2; 1-acylglycerol-3-phosphate O-acyltransferase GPAT2; xGPAT1

Protein name: glycerol-3-phosphate acyltransferase 2, mitochondrial

Full length: 795 amino acids

Entry name: GPAT2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3131-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3131-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 150763
Product information (PDF)
×
MSDS (PDF)
×