Recombinant Human GPATCH2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NW75

Gene Name: GPATCH2

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Leu171

End Site: Leu270

Coverage: 0.21

Isoelectric Point: 5.5

Core Sequence: LPQDISNKRTMTQPPEGCRDQDMDSDRAYQYQEFTKNKVKKRKLKIIRQGPKIQDEGVVLESEETNQTNKDKMECEEQKVSDELMSESDSSSLSSTDAGL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Pig - 87%, Cynomolgus monkey - 98%

Alternative gene names: GPATC2

Alternative protein names: G patch domain-containing protein 2

Protein name: G-patch domain containing 2

Full length: 528 amino acids

Entry name: GPTC2_HUMAN

• SKU: ASBPP-3207-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3207-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55105